PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00028.1.g04380.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 138aa    MW: 14981.7 Da    PI: 9.8468
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00028.1.g04380.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.6e-3171124255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtpeLH rF++ave+LGG+++AtPk +l lm+vkgL++ hvkSHLQ+YR+
  Zjn_sc00028.1.g04380.1.sm.mk  71 PRLRWTPELHLRFLRAVERLGGQDRATPKLVLLLMNVKGLSIGHVKSHLQMYRS 124
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-2967125IPR009057Homeodomain-like
PROSITE profilePS5129412.95167127IPR017930Myb domain
SuperFamilySSF466891.08E-1568125IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2370126IPR006447Myb domain, plants
PfamPF002499.3E-1072123IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MEEISSKSFA SSKNQGDPEE GDAAADAPHY CHEGSSSHSS SVDMEVAAGG NSSRKTAASS  60
SVRPYVRSKN PRLRWTPELH LRFLRAVERL GGQDRATPKL VLLLMNVKGL SIGHVKSHLQ  120
MYRSKKIDDS GQGKSTDS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0379573e-78BT037957.1 Zea mays full-length cDNA clone ZM_BFb0204N03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442650.16e-51hypothetical protein SORBIDRAFT_08g000510
TrEMBLC5YQ197e-51C5YQ19_SORBI; Putative uncharacterized protein Sb08g000510
STRINGSb08g000510.12e-50(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-40G2-like family protein